ELISA Recombinant Luc7-like protein 3(LUC7L3),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Epigenetics and Nuclear Signaling Uniprot ID: O95232 Gene Names: LUC7L3 Organism: Homo sapiens () AA Sequence: MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKV Expression Region: 1-79aa Sequence Info: Partial Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 13.3 kDa Alternative Name(s): Cisplatin resistance-associated-overexpressed protein;Luc7AOkadaic acid-inducible phosphoprotein OA48-18cAMP regµLatory element-associated protein 1 ;CRE-associated protein 1 ;CREAP-1 Relevance: Binds cAMP regµLatory elent DNA sequence. May play a role in RNA splicing. Reference: Identification of a family of DNA-binding proteins with homology to RNA splicing factors.Shipman K.L., Robinson P.J., King B.R., Smith R., Nicholson R.C.Biochem. Cell Biol. 84:9-19(2006) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.