Skip to Content

ELISA Recombinant Catostomus commersonii [Arg8]-vasotocin receptor

https://www.cbm15.com/web/image/product.template/121656/image_1920?unique=7485b17
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Catostomus commersonii (White sucker) Uniprot NO.:Q90352 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGRIANQTTASNDTDPFGRNEEVAKMEITVLSVTFFVAVIGNLSVLLAMHNTKKKSSRMH LFIKHLSLADMVVAFFQVLPQLCWEITFRFYGPDFLCRIVKHLQVLGMFASTYMMVMMTL DRYIAICHPLKTLQQPTQRAYIMIGSTWLCSLLLSTPQYFIFSLSEIQNGSYVYDCWGHF IEPWGIRAYITWITVGIFLIPVIILMICYGFICHSIWKNIKCKTMRGTRNTKDGMIGKVS VSSVTIISRAKLRTVKMTLVIVLAYIVCWAPFFIVQMWSVWDENFSWDDSENAAVTLSAL LASLNSCCNPWIYmLFSGHLLYDFLRCFPCCKKPRNmLQKEDSDSSIRRNTLLTKLAAGR MTNDGFGSWRDPCNSRKSSQSIGLDCFCKSSQCLEHDCSRKSSQCIPLDCSRKSSQCIPL DCSRKSSQCMSKES Protein Names:Recommended name: [Arg8]-vasotocin receptor Short name= AVT Gene Names: Expression Region:1-434 Sequence Info:fµLl length protein

1,793.00 € 1793.0 EUR 1,793.00 € Tax Excluded

1,793.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF852657CEV

Our Products !

Check out what's in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.