ELISA Recombinant Cocksfoot mottle virus Polyprotein P2A(ORF2A)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Cocksfoot mottle virus (isolate Dactylis glomerata/Norway/CfMV-NO/1995) (CfMV) Uniprot NO.:Q89504 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SKRPPICNWQSLTSKPSTRGPDPAPVSAESPGVVKTSSQKSKRSRTRGKSTSRQVPASPS PKSGSATSK Protein Names:Recommended name: Polyprotein P2A Cleaved into the following 5 chains: 1. N-terminal protein 2. Serine protease EC= 3. 3.4.21.- 4. VPg 5. Putative protein p10 6. Putative protein p8 Gene Names:ORF Names:ORF2A Expression Region:500-568 Sequence Info:fµLl length protein