ELISA Recombinant Dictyostelium discoideum Putative transmembrane protein DDB_G0272126(DDB_G0272126)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Dictyostelium discoideum (Slime mold)
Uniprot NO.:Q86JE4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTPYLKIIKSSYTLLSFFYFIANTIIRTIQNVPTSHKIILVSLYYLVFSLFITRIFYGSP LKIISTYIYGKF
Protein Names:Recommended name: Putative transmembrane protein DDB_G0272126
Gene Names:ORF Names:DDB_G0272126
Expression Region:1-72
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF769743DKK
Our Products !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.