Skip to Content

ELISA Recombinant Dictyostelium discoideum Putative transmembrane protein DDB_G0272126(DDB_G0272126)

https://www.cbm15.com/web/image/product.template/124279/image_1920?unique=9fe42c5
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Dictyostelium discoideum (Slime mold) Uniprot NO.:Q86JE4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTPYLKIIKSSYTLLSFFYFIANTIIRTIQNVPTSHKIILVSLYYLVFSLFITRIFYGSP LKIISTYIYGKF Protein Names:Recommended name: Putative transmembrane protein DDB_G0272126 Gene Names:ORF Names:DDB_G0272126 Expression Region:1-72 Sequence Info:fµLl length protein

1,411.00 € 1411.0 EUR 1,411.00 € Tax Excluded

1,411.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF769743DKK

Our Products !

Check out what's in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.