ELISA Recombinant Prochlorococcus marinus subsp. pastoris NAD(P)H-quinone oxidoreductase subunit L(ndhL)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) Uniprot NO.:Q7V2B1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MESIFNNSFATLVAYVGIVSIYLLVIPLILFYWMNNRWNVMGKFERLIVYGLVFLFFPGL ILFSPFLNLRLRGDSKG Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit L EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase I subunit L NDH-1 subunit L NDH-L Gene Names:Name:ndhL Ordered Locus Names:PMM0570 Expression Region:1-77 Sequence Info:fµLl length protein