ELISA Recombinant Debaryomyces hansenii Vacuolar ATPase assembly integral membrane protein VMA21(VMA21)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (TorµLaspora hansenii) Uniprot NO.:Q6BXM0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPADIPKSVVQKLVFFTAAMIICPVATFFICQYLFSNNAIISGGVSALVANIVLIGYVVA AFMEDTTEQEPEETKKSR Protein Names:Recommended name: Vacuolar ATPase assembly integral membrane protein VMA21 Gene Names:Name:VMA21 Ordered Locus Names:DEHA2B01892g Expression Region:1-78 Sequence Info:fµLl length protein