ELISA Recombinant Dictyostelium discoideum Uncharacterized transmembrane protein DDB_G0284989(DDB_G0284989)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Dictyostelium discoideum (Slime mold) Uniprot NO.:Q54NT8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MYKDYLFKSNKGYLSLTLVTLPVCSSLHCYFLWTTLSRLSSLPIDVPRSVCSVASLDLDL VIINLLSILRD Protein Names:Recommended name: Uncharacterized transmembrane protein DDB_G0284989 Gene Names:ORF Names:DDB_G0284989 Expression Region:1-71 Sequence Info:fµLl length protein