ELISA Recombinant Methanocaldococcus jannaschii Tetrahydromethanopterin S-methyltransferase subunit F(mtrF)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) Uniprot NO.:Q58262 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGVEVSNKPNVSSIQSYVEDLEYKVGLITRNRGLESGTESAGTKGLIIGVVSAIVLMGIP LALYFLMK Protein Names:Recommended name: Tetrahydromethanopterin S-methyltransferase subunit F EC= 2.1.1.86 Alternative name(s): N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit F Gene Names:Name:mtrF Ordered Locus Names:MJ0852 Expression Region:1-68 Sequence Info:fµLl length protein