ELISA Recombinant Cupriavidus pinatubonensis Protein CrcB homolog(crcB)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Cupriavidus pinatubonensis (strain JMP134 / LMG 1197) (Alcaligenes eutrophus) (Ralstonia eutropha) Uniprot NO.:Q46ZT1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGPLGFVAVGIGAAVGAWLRWGLSVMWNALNPALPYGTLAANLLGGYLIGLAVGFFDTHP GLPPEWRLLAITGFLGGLTTFSTFSSEALANLISGDYGWALLHLLSHLGGSLLFAALGLW TYRLLA Protein Names:Recommended name: Protein CrcB homolog Gene Names:Name:crcB Ordered Locus Names:Reut_A1988 Expression Region:1-126 Sequence Info:fµLl length protein