ELISA Recombinant Bovine FXYD domain-containing ion transport regulator 7(FXYD7)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q3ZBJ3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MATQVPTKVPQDPDPFYYDYDTVQTVGMTLATILFLLGILIILSKKVKCRKADSRSESPT CKSCKSELPSSAPGGGGV Protein Names:Recommended name: FXYD domain-containing ion transport regµLator 7 Gene Names:Name:FXYD7 Expression Region:1-78 Sequence Info:fµLl length protein