ELISA Recombinant Acidianus two-tailed virus Putative transmembrane protein ORF80

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Acidianus two-tailed virus (ATV) Uniprot NO.:Q3V4W4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNPAVVLFLALITSIILIILFTATIAIYHDFVTIEQNYNMTAYAQQQNTQANNVLVTGFR FLFIGLIGVTIALIIYQRRT Protein Names:Recommended name: Putative transmembrane protein ORF80 Gene Names: Expression Region:1-80 Sequence Info:fµLl length protein