ELISA Recombinant Saccharomyces cerevisiae Uncharacterized protein YKL065W-A(YKL065W-A)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:Q2V2P2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRSNILKLLQRTSRRYVSSKDFEPVIGSNPKKQTSRLMVGSVGVMIPVLLYLFYKNDSKH SEIKKIYQNEKKI Protein Names:Recommended name: Uncharacterized protein YKL065W-A Gene Names:Ordered Locus Names:YKL065W-A Expression Region:1-73 Sequence Info:fµLl length protein