Skip to Content

ELISA Recombinant Saccharomyces cerevisiae Uncharacterized protein YKL065W-A(YKL065W-A)

https://www.cbm15.com/web/image/product.template/154942/image_1920?unique=9b59aed
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:Q2V2P2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRSNILKLLQRTSRRYVSSKDFEPVIGSNPKKQTSRLMVGSVGVMIPVLLYLFYKNDSKH SEIKKIYQNEKKI Protein Names:Recommended name: Uncharacterized protein YKL065W-A Gene Names:Ordered Locus Names:YKL065W-A Expression Region:1-73 Sequence Info:fµLl length protein

1,412.00 € 1412.0 EUR 1,412.00 € Tax Excluded

1,412.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF649634SVG

Our Products !

Check out what's in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.