Skip to Content

ELISA Recombinant Drosophila pseudoobscura pseudoobscura Adenosine monophosphate-protein transferase FICD homolog(GA21854)

https://www.cbm15.com/web/image/product.template/125067/image_1920?unique=9fe42c5
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Drosophila pseudoobscura pseudoobscura (Fruit fly) Uniprot NO.:Q29JP8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAMTILHASEKVNAEAEATTCPPTEKVKEEQQQQEQLQHSKTSKRVQFYRFALFFIAGSF AAFSFHALTSSSSWRLRQLHHLPNAHYLQTREEFAVYSVEELNAFKEFYDKSISDSVGAS YSEAEQTNIKEALGALRLAQDMHLSGKDDKASRLFEHALALAPKHPEVLLRYGEFLEHNQ RNIVLADQYYFQALTLCPSNSEALANRQRTAEVVQTLDERRLQSLDSKRDALSAIHESSS ALRRAKKEAYFQHIYHSVGIEGNTMTLAQTRSILETRMAVDGKSIDEHNEILGMDLAMKY INASLVQKLEITIKDILELHRRVLGHVDPIEGGEFRRNQVYVGGHVPPGPGDLALLMQRF ERWLNSEHSSSLHPVNYAAYAHYKLVHIHPFIDGNGRTSRLLMNTLLMRAGYPPVIIPKQ QRSKYYHFLKLANEGDIRPFVRFIADCTEKTLDLYLWATSDLPQQIPmLIQTESEAGEQL AQMRSPHISAQSASIPEFYEFSGSGFQP Protein Names:Recommended name: Adenosine monophosphate-protein transferase FICD homolog EC= 2.7.7.n1 Gene Names:ORF Names:GA21854 Expression Region:1-508 Sequence Info:fµLl length protein

1,871.00 € 1871.0 EUR 1,871.00 €

1,871.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF645876DME-GB

Our Products !

Check out what's in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.