ELISA Recombinant Drosophila pseudoobscura pseudoobscura UPF0466 protein GA14609, mitochondrial(GA14609)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Drosophila pseudoobscura pseudoobscura (Fruit fly) Uniprot NO.:Q290M9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SGVYFRSGALRPKPDEMPFGLFAIFCAVIPGLFIGATISKNVANFLEENDLFVPSDDDDD ED Protein Names:Recommended name: UPF0466 protein GA14609, mitochondrial Gene Names:ORF Names:GA14609 Expression Region:35-96 Sequence Info:fµLl length protein