ELISA Recombinant Sheep Proteolipid protein 2(PLP2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Ovis aries (Sheep) Uniprot NO.:Q28597 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ISGPWSDFFRALGAVILYLMTSIVVLVERGNNSKGAAGVLGLCAAGLFGYDAYITFPSGT RRHTAAPTDPADGPVR Protein Names:Recommended name: Proteolipid protein 2 Alternative name(s): Differentiation-dependent protein A4 Intestinal membrane A4 protein Gene Names:Name:PLP2 Synonyms:A4 Expression Region:1-76 Sequence Info:fµLl length protein