Skip to Content

ELISA Recombinant Xenopus tropicalis Serine palmitoyltransferase small subunit B(sptssb)

https://www.cbm15.com/web/image/product.template/161564/image_1920?unique=871b00d
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:B0S4Q1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDVKHIKDYLSWLYYQYLLITCSYVLEPWEQSIFNTLLLTIIAMVIYSSYIFIPIHVRLA VEFFSGIFGGQHESTVALMS Protein Names:Recommended name: Serine palmitoyltransferase small subunit B Alternative name(s): Protein ADMP Small subunit of serine palmitoyltransferase B Short name= ssSPTb Gene Names:Name:sptssb Synonyms:admp, sssptb Expression Region:1-80 Sequence Info:fµLl length protein

1,419.00 € 1419.0 EUR 1,419.00 € Tax Excluded

1,419.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF534857XBF

Our Products !

Check out what's in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.