ELISA Recombinant Schizosaccharomyces pombe Succinate dehydrogenase cytochrome B subunit, mitochondrial(sdh3)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:O74882 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFATRSFCLSSSLFRPAAQLLRPAGRSTLRNVWRRSIATEHLTQTEANSRLASQRVHRPN SPHLTIYEPQLTWYLSSLHRIT Protein Names:Recommended name: Succinate dehydrogenase cytochrome B subunit, mitochondrial Gene Names:Name:sdh3 ORF Names:SPCC330.12c Expression Region:1-82 Sequence Info:fµLl length protein