Skip to Content

ELISA Recombinant Alcelaphine herpesvirus 1 Glycoprotein N(53)

https://www.cbm15.com/web/image/product.template/115968/image_1920?unique=7f7b80c
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Alcelaphine herpesvirus 1 (strain C500) (AIHV-1) (Malignant catarrhal fever virus) Uniprot NO.:O36403 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SSTPRAVTHPVLNATSNFNPTAGFYSFSCNADTYLLRLNSFSSIWALMNVFVVLVSTVVF MTYLCFTKFVHTLIYQQK Protein Names:Recommended name: Glycoprotein N Short name= gN Gene Names:Name:53 Expression Region:26-103 Sequence Info:fµLl length protein

1,417.00 € 1417.0 EUR 1,417.00 € Tax Excluded

1,417.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF523608AZG

Our Products !

Check out what's in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.