ELISA Recombinant Bacillus subtilis Uncharacterized membrane protein yuzA(yuzA)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bacillus subtilis (strain 168) Uniprot NO.:O32087 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSTIQRICLVLTIIGAINWGLIGFFQFDLVAAIFGGQGSALSRIIYGLVGIAGLINLGLL FKPNEERSREEAANPEMR Protein Names:Recommended name: Uncharacterized membrane protein yuzA Gene Names:Name:yuzA Ordered Locus Names:BSU31380 Expression Region:1-78 Sequence Info:fµLl length protein