ELISA Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0752 (AF_0752)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Archaeoglobus fµLgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Uniprot NO.:O29506
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKLSIADFEEWLRERGYDLMMGEQNFRLYLDLGFSALLFYNSNLLFSFILDKVGLKSADE RVPDRLRFEIAKRLRRIEATKDEIEIELL
Protein Names:Recommended name: Uncharacterized protein AF_0752
Gene Names:Ordered Locus Names:AF_0752
Expression Region:1-89
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF523149DOC
Our Products !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.