ELISA Recombinant Propionibacterium freudenreichii subsp. shermanii Cobalt transport protein CbiM(cbiM)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Propionibacterium freudenreichii subsp. shermanii (strain ATCC 9614 / CIP 103027 / CIRM-BIA1) Uniprot NO.:D7GIS1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MHIAEGVLPPVQCAIWFAAAAPFVVHGAVQVVKQIKHHPENRLLLATAGACTFLLSSIKL PSVTGSSSHPTGTGVGAVLFKPPVMAFMGLIVLIFQALLLAHGGITTLGANTFSMAIVGP WVGYGAYVLNKKLGGPLALGIFLAMFLSDLSTYCVTSFQLAFAYPDPSSGVLGAAEKFLG IFAISQIPLSVAEGILGILLFRFLFKVAGPQLQALGVRIGNKRTANAEVPEVAHV Protein Names:Recommended name: Cobalt transport protein CbiM Alternative name(s): Energy-coupling factor transporter probable substrate-capture protein CbiM Short name= ECF transporter S component CbiM Gene Names:Name:cbiM Ordered Locus Names:PFREUD_04590 Expression Region:1-235 Sequence Info:fµLl length protein