ELISA Recombinant Bacillus subtilis Probable protein-export membrane protein SecG(secG)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus subtilis (strain 168)
Uniprot NO.:O32233
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MHAVLITLLVIVSIALIIVVLLQSSKSAGLSGAISGGAEQLFGKQKARGLDLILHRITVV LAVLFFVLTIALAYIL
Protein Names:Recommended name: Probable protein-export membrane protein SecG
Gene Names:Name:secG Synonyms:yvaL Ordered Locus Names:BSU33630
Expression Region:1-76
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF518374BRJ
Our Products !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.