ELISA Recombinant Bacillus subtilis Probable protein-export membrane protein SecG(secG)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bacillus subtilis (strain 168) Uniprot NO.:O32233 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MHAVLITLLVIVSIALIIVVLLQSSKSAGLSGAISGGAEQLFGKQKARGLDLILHRITVV LAVLFFVLTIALAYIL Protein Names:Recommended name: Probable protein-export membrane protein SecG Gene Names:Name:secG Synonyms:yvaL Ordered Locus Names:BSU33630 Expression Region:1-76 Sequence Info:fµLl length protein