Skip to Content

ELISA Recombinant Acinetobacter sp. Alkane 1-monooxygenase(alkB)

https://www.cbm15.com/web/image/product.template/115468/image_1920?unique=bf930ac
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Acinetobacter sp. (strain ADP1) Uniprot NO.:O31250 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNAPVHVDQNFEEVINAARSMREIDRKRYLWMISPALPVIGIGILAGYQFSPRPIKKIFA LGGPIVLHIIIPVIDTIIGKDASNPTSEEIKQLENDPYYARLVKSFIPLQYIANVYACYL VSRKKTSFIDKILLGISMGAINGIAVNTAHELSHKADRLDHILSHLALVPTGYNHFRIEH PYGHHKRAATPEDPASSQMGETFYEFWPRTVFGSLKSAIEIETHRLKRKGKKFWSKDNEL LQGWGMSAAFHSSIIAIFGKGTIPYLVTQAFYGISLFEIINYIEHYGLKRQKRADGNYER TMPEHSWNNNNIVTNLFLYQLQRHSDHHAYPTRPFQALRHFDEAPELPSGYASmLLPAMI PPLWFKMMDKRVFEHYKEDLTKANIYPKRRAKILAKFGLTDPNIENGK Protein Names:Recommended name: Alkane 1-monooxygenase EC= 1.14.15.3 Alternative name(s): Alkane hydroxylase Short name= AHs Terminal alkane hydroxylase Gene Names:Name:alkB Synonyms:alkM Ordered Locus Names:ACIAD1411 Expression Region:1-408 Sequence Info:fµLl length protein

1,766.00 € 1766.0 EUR 1,766.00 € Tax Excluded

1,766.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF518225AWW

Our Products !

Check out what's in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.