ELISA Recombinant Rhodococcus erythropolis UPF0060 membrane protein RER_49640 (RER_49640)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhodococcus erythropolis (strain PR4 / NBRC 100887) Uniprot NO.:C0ZPH6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTVARSLLLFVLAALLEIGGAWLVWQGIREHKGWIWVGLGVISLGLYGLVATMQPDANFG RILAAYGGIFVAGSLLWAVVMDGFRPDRFDIAGALICLVGVGVIMYAR Protein Names:Recommended name: UPF0060 membrane protein RER_49640 Gene Names:Ordered Locus Names:RER_49640 Expression Region:1-108 Sequence Info:fµLl length protein