ELISA Recombinant Uncharacterized membrane protein yqzK(yqzK)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bacillus subtilis Uniprot NO.:C0H451 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGRFLKTAVDALKVFILFTGFTALFYYAMIWVNQEYENYHRYDKPEGSAVKVVEMDQDEK GGWFDRLIFFYQNGE Protein Names:Recommended name: Uncharacterized membrane protein yqzK Gene Names:Name:yqzK Ordered Locus Names:BSU23519 Expression Region:1-75 Sequence Info:fµLl length protein