ELISA Recombinant Pseudomonas aeruginosa UPF0060 membrane protein PSPA7_1846 (PSPA7_1846)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pseudomonas aerµginosa (strain PA7) Uniprot NO.:A6V2E4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MINYLWFVLAAFCEIAGCYAFYLWLRLGKSALWVLPGLLSLSLFALLLTRVEASYAGRAY AAYGGIYVAASLFWLAFVERSRPLWSDWLGVALCVLGASIVLFGPRLSQ Protein Names:Recommended name: UPF0060 membrane protein PSPA7_1846 Gene Names:Ordered Locus Names:PSPA7_1846 Expression Region:1-109 Sequence Info:fµLl length protein