ELISA Recombinant Lodderomyces elongisporus Cytochrome oxidase assembly protein 3, mitochondrial(COA3)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) (Yeast) (Saccharomyces elongisporus) Uniprot NO.:A5E7J0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTPALYRVRQPFFWRNTISLFVIGSIPLAAYWYTFTKMTEDEFSDIPIPPISDEELTKLK KEYEAGKQ Protein Names:Recommended name: Cytochrome oxidase assembly protein 3, mitochondrial Gene Names:Name:COA3 ORF Names:LELG_05579 Expression Region:1-68 Sequence Info:fµLl length protein