ELISA Recombinant Burkholderia vietnamiensis Probable intracellular septation protein A (Bcep1808_1842)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Burkholderia vietnamiensis (strain G4 / LMG 22486) (Burkholderia cepacia (strain R1808)) Uniprot NO.:A4JEZ2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKFLFDLFPIILFFAAFKVWGIFTATAVAIVATLAQVAWVAFRHRKVDTmLWVSLGVIVV FGGATLVLHDEKFIQWKPTVLYWLFAIGLLAARYAFGNNLIEKMMGKQLTLPHPVWDKLN VAWALFFAVLGLANLYVVHNFTESQWVNFKLFGTTGAMVVFIILQSLWLTKYLKDE Protein Names:Recommended name: Probable intracellµLar septation protein A Gene Names:Ordered Locus Names:Bcep1808_1842 Expression Region:1-176 Sequence Info:fµLl length protein