Skip to Content

ELISA Recombinant Salmonella typhimurium Oxaloacetate decarboxylase gamma chain 3(oadG3)

https://www.cbm15.com/web/image/product.template/155955/image_1920?unique=9b59aed
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) Uniprot NO.:P58650 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNSSVLLGEGFTLMFLGMGFVLAFLFLLIFAIRGMSAAVNRFFPEPVPVPKAAPAAAPAD DFARLKPVIAAAIHHHRRLNP Protein Names:Recommended name: Oxaloacetate decarboxylase gamma chain 3 EC= 4.1.1.3 Gene Names:Name:oadG3 Synonyms:dcoC Ordered Locus Names:STM0766 Expression Region:1-81 Sequence Info:fµLl length protein

1,420.00 € 1420.0 EUR 1,420.00 € Tax Excluded

1,420.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF348310SXB

Our Products !

Check out what's in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.