ELISA Recombinant herpesvirus 7 Glycoprotein N (U46)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species: herpesvirus 7 (strain JI) (HHV-7) ( T lymphotropic virus) Uniprot NO.:P52366 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:NEVDGEELFYKPTCHSDTYEIILKKFSSIWILVNTFILLCSFSLFLKYWCFKTLAKETVK GY Protein Names:Recommended name: Glycoprotein N Short name= gN Gene Names:ORF Names:U46 Expression Region:25-86 Sequence Info:fµLl length protein