ELISA Recombinant Variola virus Virion membrane protein A9 (A9L)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Variola virus (isolate /India/Ind3/1967) (VARV) (Smallpox virus) Uniprot NO.:P33835 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AIDLCRHFFMYFCEQKLRPNSFWFVVVRAIASMIMYLVLGIALLYISEQDDKKNTNNASN SNKLNESSINSNS Protein Names:Recommended name: Virion membrane protein A9 Gene Names:ORF Names:A9L Expression Region:23-95 Sequence Info:fµLl length protein