ELISA Recombinant African swine fever virus Uncharacterized membrane protein KP93L (Pret-001)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) (ASFV)
Uniprot NO.:P0CAL8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFFLGFLSVTMDYWSTKVKIYSYTLLTLLVITLICYLIHIFCKLRMKKNSVTNNMPPPPP PYTVSSRCSQYYID
Protein Names:Recommended name: Uncharacterized membrane protein KP93L
Gene Names:Ordered Locus Names:Pret-001
Expression Region:1-74
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF315503AYG
Our Products !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.