ELISA Recombinant African swine fever virus Uncharacterized membrane protein KP93L (Pret-001)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) (ASFV) Uniprot NO.:P0CAL8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFFLGFLSVTMDYWSTKVKIYSYTLLTLLVITLICYLIHIFCKLRMKKNSVTNNMPPPPP PYTVSSRCSQYYID Protein Names:Recommended name: Uncharacterized membrane protein KP93L Gene Names:Ordered Locus Names:Pret-001 Expression Region:1-74 Sequence Info:fµLl length protein