ELISA Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YEL050W-A (YEL050W-A)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P0C5M7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIVDKRHCLQAVQNYIVQINVTRTTKKRSLCCFFSTKISLFIILHLCLLVCLLLSFYFDF YPF Protein Names:Recommended name: Putative uncharacterized protein YEL050W-A Gene Names:Ordered Locus Names:YEL050W-A ORF Names:smORF167 Expression Region:1-63 Sequence Info:fµLl length protein