ELISA Recombinant Synechocystis sp. Thylakoid membrane protein ssr2422 (ssr2422)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Synechocystis sp. (strain PCC 6803 / Kazusa) Uniprot NO.:P73517 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTNNDNIRLEQISEDLEAQRHSLNEQGQRLDRIETILTNLVTEIKIYDSKLDTYQKASQQ IVNIAFGLLATSALAIIIPAVLNR Protein Names:Recommended name: Thylakoid membrane protein ssr2422 Gene Names:Ordered Locus Names:ssr2422 Expression Region:1-84 Sequence Info:fµLl length protein