ELISA Recombinant Bacillus subtilis Uncharacterized protein ywnF(ywnF)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bacillus subtilis (strain 168) Uniprot NO.:P71041 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNFYRVEQMPGFIKTEMQKIQKAVQPFMKKTVIYRFLAIPLAAFSLFNLAAFLFHASADR ESLISAGIFALLAALGLAFFKEAGYQHKQIQKTVHIYmLNRIKKSEILSEERKSSYARQI KEEPFAMRSFVEFLTEEDRRKKMY Protein Names:Recommended name: Uncharacterized protein ywnF Gene Names:Name:ywnF Ordered Locus Names:BSU36580 Expression Region:1-144 Sequence Info:fµLl length protein