Skip to Content

ELISA Recombinant Bacillus subtilis Uncharacterized protein ywnF(ywnF)

https://www.cbm15.com/web/image/product.template/118760/image_1920?unique=5f2a55b
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bacillus subtilis (strain 168) Uniprot NO.:P71041 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNFYRVEQMPGFIKTEMQKIQKAVQPFMKKTVIYRFLAIPLAAFSLFNLAAFLFHASADR ESLISAGIFALLAALGLAFFKEAGYQHKQIQKTVHIYmLNRIKKSEILSEERKSSYARQI KEEPFAMRSFVEFLTEEDRRKKMY Protein Names:Recommended name: Uncharacterized protein ywnF Gene Names:Name:ywnF Ordered Locus Names:BSU36580 Expression Region:1-144 Sequence Info:fµLl length protein

1,487.00 € 1487.0 EUR 1,487.00 € Tax Excluded

1,487.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF304079BRJ

Our Products !

Check out what's in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.