ELISA Recombinant Rubrivivax gelatinosus Light-harvesting protein B-800-850 alpha chain(pucA)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rubrivivax gelatinosus (Rhodocyclus gelatinosus) (Rhodopseudomonas gelatinosa) Uniprot NO.:P77799 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNQGKVWRVVKPTVGVPVYLGAVAVTALILHGGLLAKTDWFGAYWNGGKKAAAAAAAVAP APVAAPQAPAQ Protein Names:Recommended name: Light-harvesting protein B-800/850 alpha chain Alternative name(s): Antenna pigment protein alpha chain LH2 alpha polypeptide Gene Names:Name:pucA Expression Region:1-71 Sequence Info:fµLl length protein