ELISA Recombinant Methanosarcina mazei Tetrahydromethanopterin S-methyltransferase subunit F(mtrF)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) (Methanosarcina frisia)
Uniprot NO.:P80654
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AEEHEKGVPMVLAPQMGAIDATVESIRYRAQLIARNQKLDSGVAATGIIGFAAGFLFSLL MVIVLPVAVGL
Protein Names:Recommended name: Tetrahydromethanopterin S-methyltransferase subunit F EC= 2.1.1.86 Alternative name(s): N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit F
Gene Names:Name:mtrF Ordered Locus Names:MM_1542
Expression Region:2-72
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF301374MSN
Our Products !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.