ELISA Recombinant Pan troglodytes Natural cytotoxicity triggering receptor 3(NCR3)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Pan troglodytes (Chimpanzee)
Uniprot NO.:P61484
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNETPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAQLLPPVPGG
Protein Names:Recommended name: Natural cytotoxicity triggering receptor 3 Alternative name(s): Natural killer cell p30-related protein Short name= NK-p30 Short name= NKp30 CD_antigen= CD337
Gene Names:Name:NCR3
Expression Region:19-201
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF015551EQV
Our Products !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.