ELISA Recombinant Artemia salina NADH-ubiquinone oxidoreductase chain 3(ND3)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Artemia salina (Brine shrimp) Uniprot NO.:P19043 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:FYYINPREFVNKKVCLDREKSSPFECGFDPLEFLSYPLFIRFFVITLIFLIFDVEIYLLL PMVYLNMSSP Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 3 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 3 Gene Names:Name:ND3 Expression Region:1-70 Sequence Info:fµLl length protein