Skip to Content

ELISA Recombinant Ashbya gossypii Mitochondrial inner membrane organizing system protein AFR743W(AFR743W)

https://www.cbm15.com/web/image/product.template/117650/image_1920?unique=7f7b80c
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii) Uniprot NO.:Q751T2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSGQLEVSAPSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFGL GRGYAEGDAIFRSHAGLRAVRA Protein Names:Recommended name: Mitochondrial inner membrane organizing system protein AFR743W Gene Names:Ordered Locus Names:AFR743W Expression Region:1-82 Sequence Info:fµLl length protein

1,422.00 € 1422.0 EUR 1,422.00 € Tax Excluded

1,422.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF741593DOT

Our Products !

Check out what's in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.