ELISA Recombinant Schizosaccharomyces pombe V-type proton ATPase subunit e(vma9)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:Q69Z14 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGGLVVLLVGLLTALMSVVSYYVSPKGNNTSTWQMSLILTFSCCYLLWAITYLAQLHPLE APSRVLE Protein Names:Recommended name: V-type proton ATPase subunit e Short name= V-ATPase subunit e Alternative name(s): Vacuolar proton pump subunit e Gene Names:Name:vma9 ORF Names:SPBC1685.16 Expression Region:1-67 Sequence Info:fµLl length protein