ELISA Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0292940(DDB_G0292940)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Dictyostelium discoideum (Slime mold) Uniprot NO.:Q54CM6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFIFFINTPTPPNIFFSKNIKIKKLMRFSCTEVCIFFSLIFFFFFFFFCVNWGCENNLLS RKYQMNRDTCNF Protein Names:Recommended name: Putative uncharacterized protein DDB_G0292940 Gene Names:ORF Names:DDB_G0292940 Expression Region:1-72 Sequence Info:fµLl length protein