ELISA Recombinant Edwardsiella tarda Protein AaeX(aaeX)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Edwardsiella tarda (strain EIB202) Uniprot NO.:D0ZF88 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGTLPVMVLFGLSFPPAFFALLAALPLFWLLRRLLQPSGLYDMIWHPALFNCALYGCLFY LVSWLFI Protein Names:Recommended name: Protein AaeX Gene Names:Name:aaeX Ordered Locus Names:ETAE_3128 Expression Region:1-67 Sequence Info:fµLl length protein