ELISA Recombinant Haemophilus influenzae Uncharacterized protein HI_0650 (HI_0650)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Uniprot NO.:P44028
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIKIFIFLTALIVLSGCGSVVKLIDPTEKYTAYAGVAYDLEMAQQWGLPILDLPLSFLLD TVLLPYAWAQ
Protein Names:Recommended name: Uncharacterized protein HI_0650
Gene Names:Ordered Locus Names:HI_0650
Expression Region:1-70
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF337620HTA
Our Products !
Check out what's in our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.