Skip to Content

ELISA Recombinant Haemophilus influenzae Uncharacterized protein HI_1495 (HI_1495)

https://www.cbm15.com/web/image/product.template/128466/image_1920?unique=4552294
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) Uniprot NO.:P44219 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGFSELFTNADGRLSTTASIQFWGFVAATGVLLYSVYLDKPYVPEMFSTFLFACVGTAAT KGVANALSQRREQGKEQGREQGREQE Protein Names:Recommended name: Uncharacterized protein HI_1495 Gene Names:Ordered Locus Names:HI_1495 Expression Region:1-86 Sequence Info:fµLl length protein

1,426.00 € 1426.0 EUR 1,426.00 € Tax Excluded

1,426.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF332141HTA

Our Products !

Check out what's in our Lab !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.