ELISA Recombinant African swine fever virus Uncharacterized membrane protein KP93L (War-001)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:African swine fever virus (isolate Warthog/Namibia/Wart80/1980) (ASFV) Uniprot NO.:P0CAL9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFFFGFLSATMCYWTSHRTTDYSYIVLSILVIILIWYLILICCRSKKNVVINNMPPSPPP YTVSSSYS Protein Names:Recommended name: Uncharacterized membrane protein KP93L Gene Names:Ordered Locus Names:War-001 Expression Region:1-68 Sequence Info:fµLl length protein