ELISA Recombinant Bacillus subtilis Negative regulatory protein yxlD(yxlD)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bacillus subtilis (strain 168) Uniprot NO.:P94372 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTQTEIIITVAACLIVLAQGIFLFIDAKKRNHMAWVWGIVGLIQAPMPLICYYFFVIRPD RKKRGIKQ Protein Names:Recommended name: Negative regµLatory protein yxlD Gene Names:Name:yxlD Ordered Locus Names:BSU38680 Expression Region:1-68 Sequence Info:fµLl length protein